Name :
TNFSF15 (Human) Recombinant Protein

Biological Activity :
Human TNFSF15 partial recombinant protein with His tag in C-terminus expressed in Escherichia coli.

Tag :

Protein Accession No. :
O95150

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=9966

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMLKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Molecular Weight :
22.7

Storage and Stability :
Store at 4°C for one weeks and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
chromatographic

Quality Control Testing :

Storage Buffer :
Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 50% glycerol, 1 mM DTT, 0.2 M NaCl.

Applications :
SDS-PAGE,

Gene Name :
TNFSF15

Gene Alias :
MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A

Gene Description :
tumor necrosis factor (ligand) superfamily, member 15

Gene Summary :
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined. [provided by RefSeq

Other Designations :
OTTHUMP00000022739|TNF ligand-related molecule 1|TNF superfamily ligand TL1A|vascular endothelial cell growth inhibitor|vascular endothelial growth inhibitor-192A

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-31 Proteinmanufacturer
SCF ProteinGene ID
Popular categories:
Glycoprotein IIb/IIIa
Nuclear Receptor Subfamily 4 Group A Member 2