Human growth hormone-releasing factor is a hypothalamic polypeptide for GH production research

**Background**

Growth hormone (GH) plays a critical role in maintaining metabolic homeostasis and promoting growth throughout the human lifespan. The regulation of GH is primarily controlled by the hypothalamus, which secretes specific peptides to modulate the anterior pituitary gland. Among these, the growth hormone-releasing hormone (GHRH) is essential for the synthesis and secretion of GH from pituitary somatotropes. Dysregulation of this axis is often associated with metabolic disorders, including diabetes, making the study of GHRH signaling a focal point for endocrine research. In this context, we will introduce a potent hypothalamic polypeptide – Human growth hormone-releasing factor.

**Definition**

Human growth hormone-releasing factor is a hypothalamic polypeptide that stimulates the production and release of growth hormone by binding to the GHRH receptor (GHRHR) on cells in the anterior pituitary. According to the Human growth hormone-releasing factor description, this peptide consists of a specific 44-amino acid sequence (YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2) with a molecular weight of 5039.65 (free base).

**Mechanism of Action**

The GHRHR is a member of the class II B GPCR family, which predominantly couples to the Gs-adenylate cyclase-cAMP signaling pathway. Human growth hormone-releasing factor In Vitro activity is characterized by its ability to activate these receptors, mirroring the action of other peptide hormones such as secretin, glucagon-like peptides, and vasoactive intestinal peptide. Expressed in the arcuate nucleus of the hypothalamus and released into the portal vasculature, the peptide directly stimulates growth hormone synthesis. Researchers seeking detailed Human growth hormone-releasing factor technical information can observe that this activation is central to the regulation of somatotrope function.

**Experimental Application**

The biological utility of this peptide is well-documented in endocrine studies. By utilizing the Human growth hormone-releasing factor biological activity, researchers can investigate the interplay between GHRH and metabolic diseases. For instance, studies have explored the role of growth hormone-releasing hormone in the context of diabetes to understand how GH deficiency or excess impacts glucose metabolism. The peptide’s precise Human growth hormone-releasing factor Formula (C 215 H 358 N 72 O 66 S.xC 2 HF 3 O 2) ensures high specificity for the GHRHR, allowing for accurate modeling of the hypothalamic-pituitary-somatotropic axis. In conclusion, Human growth hormone-releasing factor is a critical tool for studying the stimulation of growth hormone production and its implications in metabolic health.

Keywords

Human growth hormone-releasing factor, Growth Hormone Releasing Factor human, Somatorelin (1-44) amide (human), GHSR, Growth hormone secretagogue receptor, Ghrelin receptor, Hypothalamic, peptide, growth, hormone, Inhibitor, inhibitor, inhibit

References

[1] Fridlyand LE, et al.Growth Hormone-Releasing Hormone in Diabetes.Front Endocrinol (Lausanne). 2016 Oct 10;7:129. eCollection 2016.