Recombinant Human GRIN2A, N-His
Name : Recombinant Human GRIN2A, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q12879
Synonyms :
Recombinant Human GRIN2A, N-His
Amino Acid Sequence :
Molecular Weight :
17.90 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human GRIN2A(Pro401-Arg539) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
353-09-3 MedChemExpress 53-86-1 custom synthesis PMID:31194406 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant huamn Angiopoietin-related protein 2
Product Name :
Recombinant huamn Angiopoietin-related protein 2
Brief Description :
Recombinant Protein
Accession No. :
Q9UKU9
Calculated MW :
70.8 kDa
Target Sequence :
QEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSARPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q9UKU9
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Parathyroid Hormone Antibody manufacturer Efalizumab Biological Activity PMID:35042120 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human MFGE8, N-His
Name : Recombinant Human MFGE8, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q08431
Synonyms :
Recombinant Human MFGE8, N-His
Amino Acid Sequence :
Molecular Weight :
43.08 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human MFGE8(Leu24-Cys387) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
127-07-1 IUPAC Name 58-85-5 Biological Activity PMID:30860743 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant human Dual specificity protein phosphatase 26
Product Name :
Recombinant human Dual specificity protein phosphatase 26
Brief Description :
Recombinant Protein
Accession No. :
Q9BV47
Calculated MW :
39.9 kDa
Target Sequence :
MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q9BV47
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
ARL3 Antibody Purity & Documentation Betanin Formula PMID:34283420 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human ABCA4, N-His
Name : Recombinant Human ABCA4, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
P78363
Synonyms :
Recombinant Human ABCA4, N-His
Amino Acid Sequence :
Molecular Weight :
39.17 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human ABCA4(Gly1398-Asn1727) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
18378-89-7 Formula 477775-14-7 References PMID:30725801 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Human CTLA-4 Protein, hFc tag
Product Name :
Human CTLA-4 Protein, hFc tag
Brief Description :
Accession No. :
Calculated MW :
39.6 kDa
Target Sequence :
Storage :
Store at -80˚C for 12 months (Avoid repeated freezing and thawing)
Application Details :
Uniprot :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
IGHM Antibody Cancer Calcitonin Antibody In Vitro PMID:35116190 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human MSH6, N-His
Name : Recombinant Human MSH6, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
P52701
Synonyms :
Recombinant Human MSH6, N-His
Amino Acid Sequence :
Molecular Weight :
46.37 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human MSH6(Met1-Glu400) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
863588-32-3 Synonym 847163-28-4 MedChemExpress PMID:29083569 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant human Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
Product Name :
Recombinant human Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
Brief Description :
Recombinant Protein
Accession No. :
Q8WUK0
Calculated MW :
35.9 kDa
Target Sequence :
KVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q8WUK0
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
RGS13 Antibody Epigenetics Eprenetapopt Technical Information PMID:35255339 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human GJA5, N-His
Name : Recombinant Human GJA5, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
P36382
Synonyms :
Recombinant Human GJA5, N-His
Amino Acid Sequence :
Molecular Weight :
17.04 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human GJA5(Tyr227-Val358) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
133407-82-6 medchemexpress 1397-89-3 Description PMID:31424896 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant mouse Hemoglobin subunit beta-2
Product Name :
Recombinant mouse Hemoglobin subunit beta-2
Brief Description :
Recombinant Protein
Accession No. :
P02089
Calculated MW :
42.7 kDa
Target Sequence :
VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P02089
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Ansuvimab custom synthesis HAO1 Antibody References PMID:34782438 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com