1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride

Product Name :
1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride

Synonym :
EDC.HClEDAC.HClWater Soluble CarbodiimideN-Ethyl-N’-(3-dimethylaminopropyl)carbodiimide HCl1-Ethyl-3-(3-dimethylaminopropyl)carb odiimide HCl

Chemical Name :

CAS NO.:
25952-53-8

Molecular formula :
C8H18ClN3

Molecular Weight:
191.7 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Coupling Reagents > Carbodiimides > 1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride

Description:
Commonly known as EDAC, EDC or EDCI, this carbodiimide HCl salt is used as a coupling reagent in the synthesis of amides and carboxylic esters. EDAC is highly soluble in water and in most organic solvents, it can be employed in liquid and solid-phase and synthesis. The major advantage of EDCI over other carbodiimides such as DCC and DIC is the ease of purification of the product from the water-soluble urea by-product by washing the crude mixture with water or mild acid and extracting in the organic phase. The main applications of EDAC are in peptide synthesis, Steglich esterification reactions in presence of catalytic DMAP, immunoconjugate synthesis, synthesis of sulfo-NHS esters and coupling of biomolecules onto solid supports.

Purity :
>98%

Specifications :
5 g

Price.:
30

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
67469-78-7 custom synthesis 70288-86-7 site PMID:28846314 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Gastrin-releasing peptide

Product Name :
Gastrin-releasing peptide

Brief Description :
Recombinant Protein

Accession No. :
P07492Gene name:GRP

Calculated MW :

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P07492

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
14-3-3 eta Antibody custom synthesis Anti-Clathrin Heavy Chain Antibody Protocol PMID:35165542 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Benzyltriethylammonium borohydride

Product Name :
Benzyltriethylammonium borohydride

Synonym :
N,N,N-Triethyl-benzenemethanaminium tetrahydroborate

Chemical Name :

CAS NO.:
85874-45-9

Molecular formula :
C13H26BN

Molecular Weight:
207.16 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Benzyltriethylammonium borohydride

Description:
Benzyltriethylammonium borohydride is a chemical compound that is used as a catalyst for the reduction of quinoline derivatives. It has been shown to reduce the functional groups in benzyl-substituted quinolines to form benzylic alcohols. Benzyltriethylammonium borohydride has been used to treat Alzheimer’s disease by reducing amyloid beta plaques in the brain. This compound can also be used as an analytical reagent and can be used to stain proteins, polysaccharides, and nucleic acids. Benzyltriethylammonium borohydride has a polymorphic nature with two different crystal structures: one that is thermodynamically stable at room temperature and another that is kinetically stable at high temperatures. The thermodynamically stable structure occurs in the presence of alkali metals such as lithium or sodium hydroxide, while the kinetically stable structure occurs in the absence of alk

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
144875-48-9 IUPAC Name 1405-10-3 supplier PMID:30725752 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Progonadoliberin-1

Product Name :
Progonadoliberin-1

Brief Description :
Recombinant Protein

Accession No. :
P13562Gene name:Gnrh1

Calculated MW :
7.59

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P13562

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CD57 Antibody References Apocynin Metabolic Enzyme/Protease PMID:34212831 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Carotegrast

Product Name :
Carotegrast

Synonym :

Chemical Name :

CAS NO.:
401904-75-4

Molecular formula :
C27H24Cl2N4O5

Molecular Weight:
555.4 g/mol

Classification :
MedChemExpress Products > Life Sciences > Carotegrast

Description:
Carotegrast is a drug that has been approved for the treatment of HIV infection. It is a prodrug that is hydrolyzed in vivo to carotegravir and piperazine. Carotegravir inhibits the HIV-1 protease, blocking the processing of viral proteins, which prevents new virus particles from being released. The activity of carotegravir has been shown in vitro and in clinical trials to be similar to that of other protease inhibitors such as saquinavir and ritonavir. Piperazine, a piperazine compound, has antiviral properties and may help to prevent HIV-1 replication by inhibiting reverse transcriptase activity. Carotegrast is effective against a wide range of HIV-1 subtypes and strains, including multidrug resistant isolates. This drug also has an excellent safety profile with no significant adverse events reported during clinical trials.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
305

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
58-05-9 Formula 22978-25-2 Synonym PMID:25905393 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Thyroid peroxidase

Product Name :
Thyroid peroxidase

Brief Description :
Recombinant Protein

Accession No. :
P07202Gene name:TPO

Calculated MW :
14.3

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P07202

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
LHX1 Antibody Epigenetics ALPL Antibody custom synthesis PMID:35260897 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Albendazole-D3

Product Name :
Albendazole-D3

Synonym :

Chemical Name :

CAS NO.:
1353867-92-1

Molecular formula :

Molecular Weight:

Classification :
MedChemExpress Products > Research Chemicals >Fine Chemicals > Albendazole-D3

Description:
Albendazole-D3 is an anthelmintic drug that is dispersive in nature and is used to treat various types of worm infestations. It is a prodrug, which undergoes hydrolysis to the active form albendazole in aqueous solution. Albendazole-D3 has been shown to have linear response on the calibration curve and has no significant effect on the residue analysis of sulfoxide and acetonitrile. This drug also has a deuterated form for use in bioequivalence studies. The matrix effect can be eliminated by running experiments with magnesium as a tracer. The derivative can be expressed as [(CH)AlB]+.

Purity :
>98%

Specifications :
1 mg

Price.:
390

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
154229-18-2 site 3375-31-3 SMILES PMID:29369572 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Interferon beta

Product Name :
Interferon beta

Brief Description :
Recombinant Protein

Accession No. :
P01574Gene name:IFNB1

Calculated MW :
18.26

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P01574

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Glycerol-d5 Endogenous Metabolite Phospho-STAT1 Antibody web PMID:34724570 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Microhelenin C

Product Name :
Microhelenin C

Synonym :

Chemical Name :

CAS NO.:
63569-07-3

Molecular formula :
C20H26O5

Molecular Weight:
346.4 g/mol

Classification :
MedChemExpress Products > Natural Products > Microhelenin C

Description:
Microhelenin C is a natural product isolated from the plant Microhelenium nakaii. It is an analytical reference material with a purity of at least 99.5% and is used in quality control, screening, and research and development. Microhelenin C has been shown to have high bioactivity in vitro, but little information is available about its mechanism of action or its effect on human health.

Purity :
>98%

Specifications :
1 mg

Price.:
170

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
107724-20-9 Molecular Weight 839712-12-8 IUPAC Name PMID:31082065 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human Myelin proteolipid protein(PLP1)

Product Name :
Recombinant Human Myelin proteolipid protein(PLP1)

Brief Description :
Recombinant Protein

Accession No. :
P60201

Calculated MW :
35.5 kDa

Target Sequence :
GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P60201

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CD94 Antibody In stock NRCAM Antibody Protocol PMID:34750787 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com